"initiatorDataMatcher" : "data-lia-kudos-id" // enable redirect to login page when "logmein" is typed into the void =) } } }, { "actions" : [ { "action" : "rerender" }, var resetMenu = function() { { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); } { } } }, "forceSearchRequestParameterForBlurbBuilder" : "false", "action" : "rerender" ;(function($) { LITHIUM.Dialog({ "action" : "rerender" ;(function($) { "}); "action" : "rerender" . "context" : "", } }, }); "displayStyle" : "horizontal", "quiltName" : "ForumMessage", LITHIUM.AjaxSupport.useTickets = false; LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); ;(function($) { $(this).next().toggle(); "action" : "rerender" } "action" : "rerender" }, "eventActions" : [ ] ] } "action" : "rerender" "parameters" : { { var count = 0; }, }, } })(LITHIUM.jQuery); "context" : "envParam:quiltName,expandedQuiltName", }, { "actions" : [ }, "action" : "rerender" }, }, "quiltName" : "ForumMessage", "event" : "addThreadUserEmailSubscription", "action" : "rerender" }, ] "event" : "ProductAnswerComment", ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { } "activecastFullscreen" : false, "disableLabelLinks" : "false", LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); ] { ] "actions" : [ } }, { "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); "}); ] "event" : "MessagesWidgetEditAction", "disableLabelLinks" : "false", ] "event" : "QuickReply", "action" : "rerender" "context" : "envParam:quiltName,expandedQuiltName", "selector" : "#kudosButtonV2_4", "entity" : "1624262", ] ] //$('#lia-body').removeClass('lia-window-scroll'); }, ] "linkDisabled" : "false" "context" : "", "context" : "envParam:quiltName,message", Mit der automatischen Vorschlagsfunktion können Sie Ihre Suchergebnisse eingrenzen, da während der Eingabe mögliche Treffer angezeigt werden. "context" : "envParam:quiltName", ] LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}}); }, LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); "useCountToKudo" : "false", "useTruncatedSubject" : "true", })(LITHIUM.jQuery); }, "action" : "rerender" LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); Execute whatever should happen when entering the right sequence "entity" : "1623733", "action" : "rerender" "action" : "rerender" //$('#vodafone-community-header').css('display','block'); element.find('li').removeClass('active'); ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { }, Mehr Infos. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); ], ] "action" : "rerender" "useSubjectIcons" : "true", ', 'ajax'); { } "event" : "removeThreadUserEmailSubscription", .attr('aria-expanded','true') "context" : "", }, "context" : "envParam:quiltName", { "actions" : [ LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, 'LKz-M9qJsVeY0lzK0p_qztKVMr-IQvQAJ0aVonNSX98. "quiltName" : "ForumMessage", { "event" : "removeMessageUserEmailSubscription", "context" : "", { "displayStyle" : "horizontal", { ] ] ] } "context" : "", "useSimpleView" : "false", "context" : "", "context" : "envParam:quiltName,message", { ] } }); "parameters" : { } ] "context" : "", { "kudosable" : "true", "actions" : [ "disableKudosForAnonUser" : "false", { "forceSearchRequestParameterForBlurbBuilder" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); } "event" : "ProductAnswerComment", } { "parameters" : { "disableKudosForAnonUser" : "false", "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" }, } // Oops, not the right sequence, lets restart from the top. "action" : "rerender" { }, } else { // console.log(key); } { { "actions" : [ "action" : "rerender" "actions" : [ "action" : "rerender" "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); "context" : "", { "event" : "removeThreadUserEmailSubscription", element.siblings('li').children('ul').slideUp(); }, } { } ] LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; "entity" : "1623649", "event" : "MessagesWidgetEditAction", "context" : "envParam:quiltName,expandedQuiltName", { { }, "showCountOnly" : "false", ] ], { } LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); $(document).ready(function(){ "useSubjectIcons" : "true", }, "event" : "ProductMessageEdit", "forceSearchRequestParameterForBlurbBuilder" : "false", }); "disableLinks" : "false", "useSimpleView" : "false", "context" : "", var clickedDomElement = $(this); { ] "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox","feedbackSelector":".InfoMessage"}); { "action" : "pulsate" ] } "context" : "envParam:quiltName,message", "action" : "rerender" "defaultAriaLabel" : "", }, }, if ( !watching ) { "actions" : [ "actions" : [ "initiatorBinding" : true, { "action" : "rerender" "disallowZeroCount" : "false", ], "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" } "action" : "rerender" ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_7decdd7b2b285_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/Archiv_Mobilfunk/thread-id/204742&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); //$('#community-menu-toggle').removeClass('active') } { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1623733,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { } "action" : "rerender" LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); eine Provision vom Händler, z.B. "action" : "rerender" { { "actions" : [ "quiltName" : "ForumMessage", "actions" : [ "action" : "pulsate" "useSimpleView" : "false", { "eventActions" : [ LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1623645 .lia-rating-control-passive', '#form'); "initiatorBinding" : true, "event" : "expandMessage", .attr('aria-expanded','true'); { } var topicIdCustomAnnouncement = clickedDomElement.data("message-id"); { "truncateBody" : "true", "displayStyle" : "horizontal", "event" : "QuickReply", "actions" : [ LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. }, "actions" : [ "revokeMode" : "true", { { "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_3","feedbackSelector":".InfoMessage"}); "entity" : "1623733", "actions" : [ Sie bekommen von Ihrem bisherigen Anbieter eine Bestätigung und haben dann bis zu 30 Tage Zeit, uns mit der Rufnummern-Mitnahme zu beauftragen. ;(function($) { { }, { "context" : "envParam:quiltName,message,product,contextId,contextUrl", // Reset the conditions so that someone can do it all again. "action" : "pulsate" { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/204742","ajaxErrorEventName":"LITHIUM:ajaxError","token":"mii2oLzY3FuudLG-JFY_iPXq6fTPG1_9bgZTLobOlCI. }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7","feedbackSelector":".InfoMessage"}); { "context" : "", "forceSearchRequestParameterForBlurbBuilder" : "false", Jeder Anbieter ist gesetzlich zur Rufnummernportierung verpflichtet. }, "showCountOnly" : "false", ] }, "action" : "rerender" }, "event" : "MessagesWidgetMessageEdit", }, "event" : "addThreadUserEmailSubscription", { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "context" : "", "actions" : [ { LITHIUM.Dialog.options['-892400015'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, 'mI4LQ7WLF-3YOhwQ79DS4QIQpdLKa17VyAFZdqhNYnc. "event" : "kudoEntity", Rufnummernmitnahme zu Vodafone einfach erklärt: Mit unserer Anleitung direkt wechseln, Geld sparen und Bonus kassieren. "linkDisabled" : "false" "event" : "ProductAnswerComment", "event" : "QuickReply", "componentId" : "kudos.widget.button", "event" : "addMessageUserEmailSubscription", count = 0; }, "context" : "envParam:quiltName,expandedQuiltName", $(this).toggleClass("view-btn-open view-btn-close"); LITHIUM.Dialog.options['-834787786'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "event" : "MessagesWidgetEditCommentForm", "action" : "rerender" "context" : "", watching = true; "action" : "rerender" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1623649 .lia-rating-control-passive', '#form_1'); } { "}); { var key = e.keyCode; "useSubjectIcons" : "true", "action" : "rerender" ] "actions" : [ "useSubjectIcons" : "true", "actions" : [ var count = 0; }, "action" : "rerender" { "disableLabelLinks" : "false", }, } } count++; LITHIUM.AjaxSupport.ComponentEvents.set({ })(LITHIUM.jQuery); // Pull in global jQuery reference } "actions" : [ ] "linkDisabled" : "false" { count = 0; } "componentId" : "kudos.widget.button", "messageViewOptions" : "1111110111111111111110111110100101001101" "actions" : [ ] "actions" : [ { "action" : "rerender" { { { "context" : "", "actions" : [ }, { "actions" : [ }, // Oops, not the right sequence, lets restart from the top. }, LITHIUM.AjaxSupport.fromForm('#form_5', 'GiveRating', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true);

Wolf Mosel Pension, Kartoffeln Mit Thunfisch überbacken, Wetter Zürich Wochenende, Excel Funktion In Englisch, Typescript Foreach Object, Goethe-zertifikat B2 Wortliste Pdf, Aleppo Grill Osnabrück,