{ "}); { { if ( neededkeys[count] == key ) { "displayStyle" : "horizontal", ] "action" : "rerender" "useSubjectIcons" : "true", "actions" : [ }, "action" : "rerender" }, "action" : "rerender" $(this).toggleClass("view-btn-open view-btn-close"); { }, "initiatorBinding" : true, "context" : "", "message" : "917688", if (val.trim() == "") }); { "event" : "removeThreadUserEmailSubscription", "context" : "", "actions" : [ // We're good so far. "event" : "QuickReply", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); "event" : "MessagesWidgetEditAnswerForm", "disallowZeroCount" : "false", { "eventActions" : [ { }, "event" : "MessagesWidgetEditAction", "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_8","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_8","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv/thread-id/225445","ajaxErrorEventName":"LITHIUM:ajaxError","token":"yJmrhIQsAoudFf8eJSF8a7ly5dFecTaDy0udmLoCbgc. ] "actions" : [ "event" : "MessagesWidgetAnswerForm", ] }, "action" : "rerender" watching = false; "disableLabelLinks" : "false", "actions" : [ } "context" : "envParam:quiltName,message,product,contextId,contextUrl", "actions" : [ }, { $(document).ready(function(){ "context" : "lia-deleted-state", "actions" : [ { }, "actions" : [ } "includeRepliesModerationState" : "false", "selector" : "#messageview_7", "context" : "envParam:entity", "displayStyle" : "horizontal", window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":627,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXA1YBAFJTD1MGBBgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBUGVFAEAAZVURQHUwcBSQEKVVBIVwdbVk9bAAVUAgNQBlVfC1NAThUPVn1bVgB\/AhsIQCNFB11aQhBJFA1aYAcRQzIHYkFXF09EAxAxJ3shdmcUWwEWIGt9L0JaAUZAVVUARUZueicwckRBXERbBhgPXQ9dQnsteHpgEloUG0Q="}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; }, ] } ] if (doChecks(pagerId, val)) ] { "action" : "rerender" "actions" : [ "disableKudosForAnonUser" : "false", "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "kudoEntity", "context" : "", } "action" : "rerender" "context" : "envParam:quiltName,product,contextId,contextUrl", "context" : "", "actions" : [ "actions" : [ "truncateBodyRetainsHtml" : "false", } "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ "action" : "rerender" } "event" : "editProductMessage", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_5","componentSelector":"#lineardisplaymessageviewwrapper_5","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":917685,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "revokeMode" : "true", "initiatorDataMatcher" : "data-lia-message-uid" "event" : "removeMessageUserEmailSubscription", }, "initiatorDataMatcher" : "data-lia-message-uid" }, { "context" : "", "event" : "RevokeSolutionAction", "}); ] "useSimpleView" : "false", "event" : "MessagesWidgetEditAnswerForm", "action" : "rerender" "context" : "", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_7","componentSelector":"#lineardisplaymessageviewwrapper_7","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":917687,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { { } ] { } "actions" : [ { { "action" : "pulsate" ] "messageViewOptions" : "1111110111111111111110111110100101001101" "event" : "removeMessageUserEmailSubscription", "parameters" : { }, "context" : "", ] "event" : "unapproveMessage", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { Präfixlänge (IPv6) lässt sich ein Mitglied des Netzwerkes eindeutig adressieren und kann IP-Pakete empfangen. ] { } "event" : "MessagesWidgetEditAnswerForm", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":917683,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "}); { "context" : "envParam:quiltName,expandedQuiltName", "actions" : [ } Die Nachteile hat mason ja super erklärt. "context" : "lia-deleted-state", { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_7","menuItemsSelector":".lia-menu-dropdown-items"}}); { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-917686 .lia-rating-control-passive', '#form_6'); } LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); }, { "actions" : [ Soll/kann man die Option aktivieren oder vorerst noch warten,weil ich bin mir da nicht sicher, wie sich der Router danach verhalten bzw. } "context" : "", "parameters" : { }, } "actions" : [ "includeRepliesModerationState" : "false", ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_3","feedbackSelector":".InfoMessage"}); { "action" : "rerender" { "event" : "kudoEntity", } "action" : "rerender" } } { { { "actions" : [ ] watching = true; } "context" : "", o.innerHTML = "Page must be an integer number. "action" : "rerender" "actions" : [ }, "truncateBodyRetainsHtml" : "false", "showCountOnly" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_41","feedbackSelector":".InfoMessage"}); }, $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, "; "actions" : [ ] "event" : "MessagesWidgetEditAction", { ] "action" : "rerender" "event" : "MessagesWidgetMessageEdit", "event" : "ProductAnswerComment", "action" : "rerender" "event" : "MessagesWidgetEditAction", { }, "event" : "QuickReply", "event" : "approveMessage", "context" : "", { $('#vodafone-community-header .lia-search-input-wrapper').hide(); "context" : "envParam:quiltName,message", }, { "action" : "rerender" }, //if(height > 430) { "context" : "envParam:quiltName", { // Set start to true only if the first key in the sequence is pressed LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); } { }, "actions" : [ "truncateBodyRetainsHtml" : "false", window.location.replace('/t5/user/userloginpage'); } "context" : "envParam:quiltName,product,contextId,contextUrl", "actions" : [ "context" : "envParam:selectedMessage", "actions" : [ } else { "event" : "MessagesWidgetAnswerForm", "context" : "", { "useCountToKudo" : "false", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "disableKudosForAnonUser" : "false", } } ] "action" : "pulsate" "actions" : [ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":917683,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. } { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "event" : "editProductMessage", }, "event" : "RevokeSolutionAction", { ] { "action" : "pulsate" { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ '; { "action" : "rerender" "event" : "markAsSpamWithoutRedirect", }, } window.location = "https://forum.vodafone.de/t5/Archiv-Internet-Telefon-TV-%C3%BCber/IP4-oder-IP6-wo-ist-Vorteil-oder-Nachteil-BITTE-UM-AUFKL%C3%84RUNG/td-p/917679" + "/page/" + val; "actions" : [ } "event" : "expandMessage", "event" : "MessagesWidgetCommentForm", { Die Netzwerkadresse leitet sich ab von der IPv6 Adresse auch genannt Prefix. $('#community-menu-toggle').click(function() { ] } "event" : "MessagesWidgetEditAction", }, $(document).ready(function(){ "action" : "addClassName" } }, { { // console.log(key); { "action" : "rerender" ] "action" : "rerender" }, $(document).keydown(function(e) { { ], { } "actions" : [ }, } "messageViewOptions" : "1111110111111111111110111110100101001101" "showCountOnly" : "false", ] { ] } }, ] "context" : "envParam:quiltName,product,contextId,contextUrl", { { "kudosLinksDisabled" : "false", { "displaySubject" : "true", "initiatorBinding" : true, ] ] { "event" : "MessagesWidgetEditCommentForm", "actions" : [ "event" : "AcceptSolutionAction", }, "displaySubject" : "true", { { "messageViewOptions" : "1111110111111111111110111110100101001101" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_47","feedbackSelector":".InfoMessage"}); "context" : "", ] "actions" : [ "selector" : "#messageview_8", "action" : "rerender" "includeRepliesModerationState" : "false", "action" : "rerender" "action" : "rerender" "event" : "expandMessage", "selector" : "#messageview_2", "context" : "", }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, { }, }, ] ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" "useTruncatedSubject" : "true", }, } }, LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; { "action" : "rerender" var watching = false; 0 2 Hausaufgaben-Lösungen von Experten. LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_7","componentSelector":"#lineardisplaymessageviewwrapper_7","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":917687,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { Nachteile. ] "actions" : [ "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" { "event" : "MessagesWidgetEditCommentForm", }, "truncateBody" : "true", "event" : "ProductMessageEdit", { "context" : "envParam:quiltName,expandedQuiltName", ] "event" : "MessagesWidgetCommentForm", "actions" : [ }, "event" : "unapproveMessage", "event" : "expandMessage", ","loaderSelector":"#lineardisplaymessageviewwrapper_7 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ] } "truncateBody" : "true", }, { { "context" : "envParam:quiltName,expandedQuiltName", }, { "event" : "MessagesWidgetCommentForm", function disableInput(pagerId) { "includeRepliesModerationState" : "false", "actions" : [ "action" : "rerender" "closeEvent" : "LITHIUM:lightboxCloseEvent", }, Befasst man sich allerdings zu spät mit dem neuen Standard, kann dies … ;(function($) { "action" : "pulsate" "event" : "RevokeSolutionAction", }); var watching = false; { }, $(document).ready(function(){ ] "event" : "removeThreadUserEmailSubscription", }, LITHIUM.AjaxSupport.fromLink('#kudoEntity_5', 'kudoEntity', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {}, '1BXaipLe_ntaOylrgFPr9o99tNI1WF3QrglJJa8LN-c.', 'ajax'); "action" : "rerender" } { } }, Wichtig ist, dass eine IP-Adresse einzigartig ist. })(LITHIUM.jQuery); "context" : "envParam:quiltName,message,product,contextId,contextUrl", "event" : "ProductAnswer", LITHIUM.MessageBodyDisplay('#bodyDisplay_7', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); ] "parameters" : { Vielen Dank im Voraus. lithstudio: [], ], { "actions" : [ }, { { var expireDate = new Date(); }, "linkDisabled" : "false" "includeRepliesModerationState" : "false", }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_44","feedbackSelector":".InfoMessage"}); "actions" : [ }, ","loaderSelector":"#lineardisplaymessageviewwrapper_8 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, }, "kudosLinksDisabled" : "false", "actions" : [ "action" : "rerender" })(LITHIUM.jQuery); } } "actions" : [ "context" : "", { }); "event" : "unapproveMessage", Diese bestehen aus acht statt bislang vier Zeichenblöcken und enthalten neben Zahlen auch Buchstaben. }); element.siblings('li').children('ul').slideUp(); { } }, }, { } LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-917686 .lia-rating-control-passive', '#form_6'); "action" : "pulsate" ] "actions" : [ "event" : "MessagesWidgetEditCommentForm", { { { "event" : "unapproveMessage", LITHIUM.Dialog.options['-936075199'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); } "event" : "removeMessageUserEmailSubscription", { { "event" : "RevokeSolutionAction", }); "buttonDialogCloseAlt" : "Schließen", "actions" : [ "event" : "kudoEntity", "componentId" : "forums.widget.message-view", "actions" : [ { "event" : "deleteMessage", }); "disableLabelLinks" : "false", { { return; }); { "revokeMode" : "true", "action" : "addClassName" "action" : "addClassName" }); "event" : "removeMessageUserEmailSubscription", "kudosable" : "true", } "actions" : [ { }, Was ist Web-Hosting? "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "disallowZeroCount" : "false", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" } $(document).ready(function(){ "context" : "envParam:quiltName,product,contextId,contextUrl", { $(document).ready(function(){ { "event" : "expandMessage", $('.css-menu').removeClass('cssmenu-open') { "actions" : [ "event" : "approveMessage", "actions" : [ document.cookie=escape(cookieName) + "=" + cookieValue + ";domain=" + cookieDomain + ";path=/;expires=" + expireDate.toUTCString(); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); { "useCountToKudo" : "false", "context" : "", "action" : "rerender" "event" : "removeMessageUserEmailSubscription", ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_205ff2578369af_1","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.tkbmessagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/Archiv/thread-id/225445&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "actions" : [ ;(function($) { }, "displayStyle" : "horizontal", LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "action" : "rerender" } { "actions" : [ { "action" : "rerender" "eventActions" : [ ] { ] "event" : "addMessageUserEmailSubscription", ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_34","feedbackSelector":".InfoMessage"}); } { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_21","feedbackSelector":".InfoMessage"}); "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", } } "componentId" : "forums.widget.message-view", "entity" : "917686", "context" : "envParam:quiltName,product,contextId,contextUrl", "event" : "approveMessage", LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); { }); { "linkDisabled" : "false" } "event" : "ProductAnswer", { } "selector" : "#kudosButtonV2_8", "actions" : [ "actions" : [ { { "triggerSelector" : ".lia-panel-dialog-trigger-event-click", function setWarning(pagerId) { ] { function clearWarning(pagerId) { { { "action" : "rerender" "action" : "rerender" "actions" : [ Bist du sicher, dass du fortfahren möchtest? "actions" : [ }, "action" : "rerender" { "context" : "", "}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "kudosable" : "true", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_9","menuItemsSelector":".lia-menu-dropdown-items"}}); "action" : "rerender" "actions" : [ "context" : "", ], { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { "event" : "ProductMessageEdit", { "truncateBody" : "true", "initiatorBinding" : true, }, "context" : "envParam:quiltName", { }, "message" : "917682", // --> ] "showCountOnly" : "false", }, document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("disabled","1");