"selector" : "#messageview_6", "actions" : [ }, }, else { Execute whatever should happen when entering the right sequence { }, ] }, "event" : "editProductMessage", "actions" : [ { "event" : "ProductMessageEdit", { ] { }, "actions" : [ { element.removeClass('active'); if (element.hasClass('active')) { "linkDisabled" : "false" { "event" : "deleteMessage", "event" : "addMessageUserEmailSubscription", ], "actions" : [ "context" : "", "useCountToKudo" : "false", "useSimpleView" : "false", var cookieDomain = 'forum.vodafone.de'; } $(document).ready(function(){ LITHIUM.AjaxSupport.fromForm('#form_5', 'GiveRating', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } "forceSearchRequestParameterForBlurbBuilder" : "false", ], "actions" : [ "action" : "rerender" { } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivKIP/thread-id/70124","ajaxErrorEventName":"LITHIUM:ajaxError","token":"yPs6VWcIXqEbQUbHjlhUaoAl6QaIHRiPmff0zhEQo7s. { "truncateBodyRetainsHtml" : "false", "actions" : [ "event" : "MessagesWidgetMessageEdit", } Vodafone stellt auf IPv6 um Foto/Logo: Vodafone, Montage: teltarif.de Seit Jahren hört man immer wieder Berichte, denen zufolge die IPv4-Adressen knapp werden. "actions" : [ "actions" : [ "event" : "markAsSpamWithoutRedirect", }, "event" : "MessagesWidgetAnswerForm", { { ] /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }, "forceSearchRequestParameterForBlurbBuilder" : "false", { "context" : "envParam:quiltName", "action" : "rerender" { "action" : "rerender" Bist du sicher, dass du fortfahren möchtest? "event" : "MessagesWidgetEditCommentForm", LITHIUM.StarRating('#any_7', false, 1, 'LITHIUM:starRating'); "ajaxEvent" : "LITHIUM:lightboxRenderComponent", ] "disableLabelLinks" : "false", } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":1074,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXA1YBAFJaAVwMBRgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVWVAoBC1QPBBRTUlsDSQECUVZIVFIKBE9QVAUAAQAKVAReXwtAThUPVn1bVgB\/AhsIQCNFB11aQmERWQNLRwwFRAlQX1BHC1EDV3sMFlIWW1ZAZjNiA1UQTkBcB2dWR0YzBDdMVxAbFV4XYHF+IHUyGVsGQnE2en4UXwBFFVhVBxEXM312ZndFQglJWwFMXgAIDBR+LHsvbRJdQEoZ"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "event" : "ProductMessageEdit", "event" : "addThreadUserEmailSubscription", }, return; { }, "event" : "AcceptSolutionAction", { "action" : "rerender" { "}); "context" : "envParam:quiltName,expandedQuiltName", "context" : "envParam:quiltName", { { "event" : "ProductAnswerComment", "actions" : [ "displayStyle" : "horizontal", ] "event" : "markAsSpamWithoutRedirect", { "action" : "rerender" ] { "showCountOnly" : "false", count = 0; "forceSearchRequestParameterForBlurbBuilder" : "false", "context" : "", "action" : "rerender" "actions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "truncateBodyRetainsHtml" : "false", { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_72515292773aaf","feedbackSelector":".InfoMessage"}); "context" : "", "disallowZeroCount" : "false", "context" : "", "eventActions" : [ $(this).toggleClass("view-btn-open view-btn-close"); ] "event" : "markAsSpamWithoutRedirect", "context" : "", "event" : "addThreadUserEmailSubscription", "context" : "", } { "context" : "envParam:quiltName,message", LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. }, "context" : "", var key = e.keyCode; "event" : "AcceptSolutionAction", "componentId" : "forums.widget.message-view", ] "event" : "expandMessage", }, "activecastFullscreen" : false, LITHIUM.StarRating('#any_0_4', true, 2, 'LITHIUM:starRating'); var topicIdCustomAnnouncement = clickedDomElement.data("message-id"); "useCountToKudo" : "false", })(LITHIUM.jQuery); "context" : "envParam:quiltName,expandedQuiltName", { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "actions" : [ { count++; "event" : "kudoEntity", "action" : "pulsate" }); "context" : "", "displayStyle" : "horizontal", "event" : "ProductAnswer", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_44","feedbackSelector":".InfoMessage"}); "action" : "rerender" }, { { { ] "actions" : [ "messageViewOptions" : "1111110111111111111110111110100101001101" "parameters" : { }, ] "actions" : [ { { ] }); "truncateBody" : "true", { ] "actions" : [ { "quiltName" : "ForumMessage", "action" : "rerender" } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { } { "includeRepliesModerationState" : "false", "action" : "rerender" "useTruncatedSubject" : "true", "parameters" : { "event" : "ProductAnswer", { "actions" : [ } { "actions" : [ "event" : "RevokeSolutionAction", }, "action" : "rerender" }); { "actions" : [ "message" : "1101280", expireDate.setDate(expireDate.getDate() + 365*10); } ] LITHIUM.StarRating('#any_0_6', true, 2, 'LITHIUM:starRating'); "context" : "", "ajaxEvent" : "LITHIUM:lightboxRenderComponent", }, "dialogContentCssClass" : "lia-panel-dialog-content", } { { { "actions" : [ "action" : "rerender" "action" : "rerender" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1615570 .lia-rating-control-passive', '#form_5'); ;(function($) { "componentId" : "kudos.widget.button", { "triggerSelector" : ".lia-panel-dialog-trigger-event-click", LITHIUM.StarRating('#any_2', false, 1, 'LITHIUM:starRating'); "context" : "envParam:quiltName,message", "actions" : [ "event" : "markAsSpamWithoutRedirect", { }); } } { ] { "actions" : [ })(LITHIUM.jQuery); } LITHIUM.Loader.runJsAttached(); LITHIUM.Dialog.options['-2120156882'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; ] "context" : "", { { }, LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_27","feedbackSelector":".InfoMessage"}); } { "action" : "pulsate" "action" : "rerender" "actions" : [ "action" : "rerender" }, "actions" : [ }); ] } } "useSimpleView" : "false", { }, { "actions" : [ { "}); // just for convenience, you need a login anyways... $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }, "action" : "rerender" /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ } "}); } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); } "parameters" : { "event" : "approveMessage", ', 'ajax'); "action" : "rerender" "useSubjectIcons" : "true", { { { { "quiltName" : "ForumMessage", "action" : "rerender" ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { "event" : "AcceptSolutionAction", }, ] }, } "context" : "envParam:quiltName,message,product,contextId,contextUrl", "parameters" : { ] "event" : "ProductAnswerComment", "quiltName" : "ForumMessage", "action" : "rerender" LITHIUM.Dialog.options['-1036855728'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "event" : "MessagesWidgetEditAnswerForm", }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1613769,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. }, ;(function($) { LITHIUM.SearchAutoCompleteToggle({"containerSelector":"#searchautocompletetoggle_7251527aa6e0b6","enableAutoCompleteSelector":".search-autocomplete-toggle-link","enableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:enableAutoComplete","disableAutoCompleteSelector":".lia-autocomplete-toggle-off","disableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:disableAutoComplete","autoCompleteSelector":".lia-autocomplete-input"});