] "parameters" : { LITHIUM.AjaxSupport.ComponentEvents.set({ count++; ] "action" : "rerender" { }, "triggerSelector" : ".lia-panel-dialog-trigger-event-click", }, { "context" : "", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_4","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_4","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivStoerungsmeldungenInternetTVTel/thread-id/282602","ajaxErrorEventName":"LITHIUM:ajaxError","token":"hINC-GGpYOOV-q2Jb_J-IEkEO_IYmni4W1nRP5v9nSI. { Bist du sicher, dass du fortfahren möchtest? "event" : "ProductAnswer", }, "actions" : [ }, { { "action" : "rerender" } LITHIUM.AjaxSupport.fromForm('#form_6', 'GiveRating', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "displaySubject" : "true", "useCountToKudo" : "false", "accessibility" : false, }); "actions" : [ "selector" : "#messageview_6", ] "actions" : [ "context" : "", ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2045484,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_0.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivStoerungsmeldungenInternetTVTel/thread-id/282602","ajaxErrorEventName":"LITHIUM:ajaxError","token":"n1ilyam5BRMp6zq8Ya16eYSa2CptG7gTJ2ciroGAyTI. "useCountToKudo" : "false", "actions" : [ }, { { "event" : "ProductAnswerComment", LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2045406}},{"elementId":"link_10","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2045432}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2045454}},{"elementId":"link_18","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2045469}},{"elementId":"link_22","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2045484}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2045523}},{"elementId":"link_30","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2045681}},{"elementId":"link_34","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2045695}}]); "actions" : [ { ] "action" : "rerender" "quiltName" : "ForumMessage", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { }, { "event" : "MessagesWidgetEditAction", }, "actions" : [ { "action" : "pulsate" { "action" : "rerender" } "includeRepliesModerationState" : "false", "action" : "rerender" } "action" : "rerender" "action" : "rerender" "context" : "envParam:quiltName,product,contextId,contextUrl", "initiatorDataMatcher" : "data-lia-kudos-id" count = 0; "event" : "AcceptSolutionAction", ] ] "}); { { LITHIUM.Auth.CHECK_SESSION_TOKEN = 'K56qtAmirWV5dDEuX7D_7zQV2q8dVuFcUwK7ebu616Q. { "context" : "", "action" : "rerender" LITHIUM.Dialog.options['1765465302'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; ] { { // If watching, pay attention to key presses, looking for right sequence. "includeRepliesModerationState" : "false", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "rerender" { { "context" : "", "entity" : "2045523", { "action" : "rerender" "event" : "RevokeSolutionAction", "action" : "rerender" ', 'ajax'); "action" : "rerender" { "revokeMode" : "true", "componentId" : "forums.widget.message-view", "closeImageIconURL" : "https://forum.vodafone.de/skins/images/45B87A006C51668DB4413BFFEA3E02D0/responsive_peak/images/button_dialog_close.svg", { }); { }, "event" : "QuickReply", "linkDisabled" : "false" "action" : "pulsate" "event" : "markAsSpamWithoutRedirect", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_39","feedbackSelector":".InfoMessage"}); "action" : "rerender" { "useCountToKudo" : "false", "actions" : [ "action" : "rerender" "displaySubject" : "true", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); "actions" : [ LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); "context" : "", ] } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivStoerungsmeldungenInternetTVTel/thread-id/282602","ajaxErrorEventName":"LITHIUM:ajaxError","token":"PObmOtCrvw1wRm9WL8Mcnr0MO593iAYUvZDAwLiu4MU. "event" : "ProductAnswer", "action" : "pulsate" ] { { }, ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_7dddb25464faf","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/ArchivStoerungsmeldungenInternetTVTel/thread-id/282602&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); }, "context" : "envParam:quiltName,expandedQuiltName", "context" : "", }, "eventActions" : [ { "context" : "", ] { "actions" : [ }, "event" : "ProductMessageEdit", "initiatorBinding" : true, }); }); "context" : "envParam:entity", LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "actions" : [ "event" : "ProductAnswerComment", { }, }, "includeRepliesModerationState" : "false", "useSubjectIcons" : "true", } "action" : "rerender" "eventActions" : [ "actions" : [ "event" : "MessagesWidgetAnswerForm", "message" : "2045406", "event" : "MessagesWidgetEditCommentForm", "includeRepliesModerationState" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_26","feedbackSelector":".InfoMessage"}); { } ] Execute whatever should happen when entering the right sequence "useSubjectIcons" : "true", "event" : "MessagesWidgetEditAnswerForm", "messageViewOptions" : "1111110111111111111110111110100101001101" { }, ] { "context" : "envParam:quiltName", }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", })(LITHIUM.jQuery); // Pull in global jQuery reference "action" : "rerender" "event" : "removeMessageUserEmailSubscription", ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "useSubjectIcons" : "true", }, } }, }); "action" : "pulsate" "context" : "envParam:quiltName,product,contextId,contextUrl", ], LITHIUM.AjaxSupport.ComponentEvents.set({ ], "action" : "rerender" "context" : "", "action" : "rerender" "messageViewOptions" : "1111110111111111111110111110100101001101" "context" : "", var ctaHTML = ''; "context" : "", { "context" : "envParam:quiltName", "componentId" : "kudos.widget.button", ] "action" : "rerender" } ] "dialogKey" : "dialogKey" "kudosable" : "true", }, } "event" : "addThreadUserEmailSubscription", } "selector" : "#kudosButtonV2_1", "displayStyle" : "horizontal", { { }, "action" : "rerender" "context" : "", } "action" : "rerender" { { "event" : "MessagesWidgetAnswerForm", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "addMessageUserEmailSubscription", { }, }, "context" : "lia-deleted-state", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_21","feedbackSelector":".InfoMessage"}); watching = false; "entity" : "2045681", "actions" : [ "selector" : "#kudosButtonV2_2", { "kudosable" : "true", } } $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ "selector" : "#messageview_2", }); "eventActions" : [ "defaultAriaLabel" : "", })(LITHIUM.jQuery); }, "action" : "rerender" ] "context" : "", "action" : "rerender" { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "action" : "rerender" $(this).next().toggle(); { "actions" : [ "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] "context" : "envParam:quiltName", }, "initiatorBinding" : true, LITHIUM.StarRating('#any_0', true, 2, 'LITHIUM:starRating'); ] "action" : "addClassName" "event" : "QuickReply", }, { "showCountOnly" : "false", } "context" : "", } "initiatorDataMatcher" : "data-lia-message-uid" }, { LITHIUM.InputEditForm("form_6", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "action" : "rerender" "disableLabelLinks" : "false", "eventActions" : [ { } "context" : "", "event" : "markAsSpamWithoutRedirect", // Set start to true only if the first key in the sequence is pressed }, { ] { watching = false; LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "actions" : [ // If watching, pay attention to key presses, looking for right sequence. }, // enable redirect to login page when "logmein" is typed into the void =) } ] LITHIUM.AjaxSupport.fromForm('#form_6', 'GiveRating', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "action" : "rerender" "context" : "lia-deleted-state", "actions" : [ } ] } { }, return; } "useSubjectIcons" : "true", "event" : "ProductAnswer", }, } { } } ] ] "action" : "rerender" "action" : "rerender" }); "action" : "rerender" { { "parameters" : { "context" : "", "event" : "approveMessage", "}); $('#node-menu li.has-sub>a').on('click', function(){ { "event" : "addMessageUserEmailSubscription", { { "displaySubject" : "true", { }, { "context" : "", "revokeMode" : "true", "action" : "rerender" "forceSearchRequestParameterForBlurbBuilder" : "false", "action" : "rerender" })(LITHIUM.jQuery); }, }, "event" : "removeThreadUserEmailSubscription", "actions" : [ LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { $('.js-close-header-announcement').on('click', clickHandler); "action" : "rerender" LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, '393t6BQZwzSPRrxehZ62xUIrCSxeoWcBZtb1c6l_Hpc. "actions" : [ "actions" : [ "quiltName" : "ForumMessage", { "action" : "rerender" "actions" : [ "action" : "addClassName" "context" : "envParam:quiltName", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivStoerungsmeldungenInternetTVTel/thread-id/282602","ajaxErrorEventName":"LITHIUM:ajaxError","token":"PObmOtCrvw1wRm9WL8Mcnr0MO593iAYUvZDAwLiu4MU. "useSubjectIcons" : "true", "event" : "removeMessageUserEmailSubscription", { } element.find('ul').slideUp(); { ] "action" : "rerender" "}); }, { "context" : "", "useSubjectIcons" : "true", "actions" : [ "event" : "addMessageUserEmailSubscription", Details im Privacy Center und in der Liste unserer Partner. ', 'ajax'); { "actions" : [ "actions" : [ "context" : "", { "entity" : "2045681", LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "event" : "MessagesWidgetAnswerForm", "action" : "rerender" "initiatorBinding" : true, { }, "context" : "", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2045695 .lia-rating-control-passive', '#form_6'); { "context" : "envParam:quiltName", { }, }, }, } } "initiatorDataMatcher" : "data-lia-message-uid" } }, "parameters" : { { if (event.target.matches('.redirect')) { "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { "}); watching = false; "event" : "editProductMessage", "actions" : [ { "action" : "rerender" "event" : "removeMessageUserEmailSubscription", "actions" : [ } "action" : "addClassName" "actions" : [ "action" : "rerender" "context" : "", } "actions" : [ ], "context" : "", } "initiatorBinding" : true, } ] LITHIUM.Dialog.options['-892400015'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; ] "actions" : [ { "initiatorDataMatcher" : "data-lia-kudos-id" ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "linkDisabled" : "false" ] "actions" : [ "parameters" : { "event" : "addThreadUserEmailSubscription", }, LITHIUM.InputEditForm("form_6", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren.