"initiatorDataMatcher" : "data-lia-kudos-id" { return; Dann. "event" : "removeMessageUserEmailSubscription", { "defaultAriaLabel" : "", }, }); "context" : "", "context" : "envParam:quiltName", { "event" : "kudoEntity", { "event" : "editProductMessage", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); "action" : "rerender" ] "context" : "lia-deleted-state", $(document).ready(function(){ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); "context" : "envParam:quiltName,message", "action" : "rerender" "context" : "envParam:feedbackData", Nutz dafür denselben Aktivierungscode. ] "disableLinks" : "false", { "context" : "envParam:entity", LITHIUM.MessageBodyDisplay('#bodyDisplay_0', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "event" : "MessagesWidgetCommentForm", LITHIUM.Loader.runJsAttached(); "kudosable" : "true", var handleOpen = function(event) { Tippe auf Jetzt kostenpflichtig buchen.Gib bitte Deine E-Mail-Adresse ein und wähl Weiter. }, ] { "actions" : [ Press release - Market Expertz - ESIM Market (2018-2025) Analysis by Top Manufacturers like Infineon Technologies, NXP Semiconductors, Giesecke & … { "initiatorBinding" : true, "eventActions" : [ "message" : "2225865", { Dann logg Dich bitte hier in Deinem Kundencenter ein. { }, "quiltName" : "ForumMessage", } else { //} else { } müssen. } "useCountToKudo" : "false", { }, ] { "action" : "rerender" "messageViewOptions" : "1111110111111111111110111110100101001101" { "action" : "rerender" Die eSIM ist als Chip schon im Gerät verbaut. "parameters" : { { count = 0; LITHIUM.Dialog({ "context" : "", ] "event" : "expandMessage", LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" "context" : "", { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/2001/thread-id/239367","ajaxErrorEventName":"LITHIUM:ajaxError","token":"DXVMcJdludEBWHhCMLg33hB6BON2_SXnOcZ0Tgeyqm4. LITHIUM.Loader.runJsAttached(); } LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'CFFVlfQSGGa0aoO2vZBFWJNl6uqfkb823x1enE-uhpI. "actions" : [ Mehr dazu findest Du bei unseren Smartwatch-Angeboten. $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); "context" : "envParam:quiltName,message,product,contextId,contextUrl", "context" : "envParam:quiltName", } "disallowZeroCount" : "false", { "actions" : [ } Deshalb wird bei Onlineabschluss zunächst eine physische Sim zugesendet die dann kostenlos in einen esim getauscht werden kann. LITHIUM.MessageBodyDisplay('#bodyDisplay', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { nutzen, Mehr "event" : "addThreadUserEmailSubscription", "event" : "deleteMessage", { Das e bei eSIM steht für embedded. "entity" : "2225865", } "event" : "kudoEntity", notifCount = parseInt($(this).html()) + notifCount; } }, Execute whatever should happen when entering the right sequence }, ] "event" : "ProductAnswerComment", { }); ] } }, } "actions" : [ ] { ] "actions" : [ }, { }); "initiatorDataMatcher" : "data-lia-kudos-id" Du bekommst das eSIM-Profil automatisch mit jedem eSIM-fähigen Smartphone. ] "actions" : [ ] "actions" : [ }, "event" : "MessagesWidgetEditAnswerForm", Lies in dieser Schritt-für-Schritt Anleitung, wie Du Dein eSIM-Profil auf Deinem Android-Smartphone aktivierst. "action" : "rerender" "eventActions" : [ "kudosLinksDisabled" : "false", element.siblings('li').find('ul').slideUp(); Wähl bitte Weiter.Gib bitte Dein Kunden-Kennwort ein, um fortzufahren. { "context" : "lia-deleted-state", "action" : "rerender" "actions" : [ "event" : "MessagesWidgetCommentForm", { } Verkkoapuri auttaa ratkaisemaan Elisan nettiyhteyksien, puheliittymien ja palveluiden vikatilanteita. } if ( key == neededkeys[0] ) { { "actions" : [ ] }, Diese kostenlosen Simkarten haben weder einen Kaufpreis noch Versandkosten und eine Aktivierungsgebühr gibt es auch … }, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ ] $('.community-menu').removeClass('active') }, LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); //}); .attr('aria-expanded','true') { "context" : "", { "action" : "rerender" { Fertig. { CookieManager = { }, "disableLinks" : "false", ] { "action" : "rerender" "initiatorDataMatcher" : "data-lia-message-uid" $(this).addClass('active') } "context" : "", var key = e.keyCode; "event" : "ProductAnswer", ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ] "event" : "MessagesWidgetAnswerForm", } "action" : "rerender" ] { ;(function($) { "event" : "expandMessage", } { { "disableLinks" : "false", window.location.replace('/t5/user/userloginpage'); ] { "action" : "rerender" { "action" : "rerender" ] LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } "message" : "2225865", var watching = false; }, $('#node-menu li.active').children('ul').show(); { How to use dual sim and esim on iphone 11 xr xs. "quiltName" : "ForumMessage", "context" : "", "action" : "pulsate" ] { { }, "actions" : [ .attr('aria-hidden','false') "actions" : [ { "actions" : [ "truncateBody" : "true", }); } "actions" : [ "event" : "addMessageUserEmailSubscription", "actions" : [ "event" : "RevokeSolutionAction", } "action" : "pulsate" "context" : "", var keycodes = { return; ] "action" : "rerender" "disallowZeroCount" : "false", ] "triggerSelector" : ".lia-panel-dialog-trigger-event-click", logmein: [76, 79, 71, 77, 69, 73, 78], } It packed with lots of features and advanced functions. "truncateBodyRetainsHtml" : "false", $(this).next().toggle(); }, Ansonsten werden einmalig 9,90 Euro berechnet - es sei denn, die bisher genutzte Betreiberkarte ist defekt. Dafür brauchst Du Deinen Aktivierungscode und den zugehörigen Bestätigungscode, also Deine ePIN. "context" : "", }); // console.log('watching: ' + key); "action" : "rerender" ;(function($) { "event" : "markAsSpamWithoutRedirect", { var keycodes = { eSIM statt physische SIM-Karte - kostenlos oder nicht? // Reset the conditions so that someone can do it all again. ] { $(document).ready(function(){ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); Starte dann den Download noch einmal. ] LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper","componentSelector":"#lineardisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2225805,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ], }); "action" : "rerender" } }, } // We made it! }, "actions" : [ "event" : "MessagesWidgetAnswerForm", $(this).removeAttr('href'); LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2225865 .lia-rating-control-passive', '#form_0'); { LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { } } "event" : "ProductMessageEdit", Bestandskunden können ihre alte SIM-Karte kostenlos durch eine eSIM ersetzen. }); { { "actions" : [ // We're good so far. "event" : "unapproveMessage", ] Oder frag Deine ePIN einfach mit der MeinVodafone-App über Mein Vertrag > SIM-Karte > Zugangsdaten ab. }, "disableKudosForAnonUser" : "false", { ] "event" : "deleteMessage", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "actions" : [ ] "useTruncatedSubject" : "true", "includeRepliesModerationState" : "false", "actions" : [ "useSubjectIcons" : "true", ] { //$('#lia-body').removeClass('lia-window-scroll'); ] watching = false; "action" : "rerender" if ( count == neededkeys.length ) { }); } { Re: Telefonische Vertragsverlängerung - besprochen... Tarifumstellung am Telefon, jetzt teurer als versp... Ich bin der Vertragspartner, kann dennoch nicht au... Anschlußpreis steht im Vertrag, obwohl anders vere... Opt-In setzen für Mitnahme meiner Vodafone Mobilfu... Warte seit knapp 2 Wochen auf eine Sim-Karte, Lieferanten-Buchhaltung / Accounts Payable, Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_2061f642b8b504_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/2001/thread-id/239367&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); count = 0; "context" : "envParam:quiltName,expandedQuiltName", "action" : "rerender" "revokeMode" : "true", ] { "event" : "ProductAnswerComment", Click here to watch a tutorial on how to activate it. "initiatorDataMatcher" : "data-lia-message-uid" { "accessibility" : false, Entweder als Hauptkarte oder zusätzlich als Vodafone OneNumber. }, In den FAQ bzw. "context" : "envParam:quiltName,message", ] "context" : "", "action" : "rerender" { "context" : "", { "actions" : [ "useSubjectIcons" : "true", Wie Blau bietet auch Ay Yildiz keine Mult… .attr('aria-hidden','false') $(this).removeAttr('href'); }, } { "action" : "rerender" "event" : "RevokeSolutionAction", "context" : "envParam:quiltName,product,contextId,contextUrl", if ( !watching ) { { }, "context" : "", LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); Bist du sicher, dass du fortfahren möchtest? "context" : "", ] ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); Neue Smartwatches von Oppo und Montblanc können den eSIM-Tarif "OneNumber" von Vodafone nutzen, da nun auch Geräte mit Google WearOS unterstützt werden. "}); "actions" : [ "action" : "rerender" ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } } { "context" : "", if(1 < 1){ Bist du sicher, dass du fortfahren möchtest? "componentId" : "kudos.widget.button", "displaySubject" : "true", $('.lia-button-wrapper-searchForm-action').removeClass('active'); LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234545}); if ( key == neededkeys[0] ) { "actions" : [ { "action" : "rerender" ] }); "context" : "envParam:quiltName,expandedQuiltName", } "displayStyle" : "horizontal", { { }, "initiatorDataMatcher" : "data-lia-kudos-id" "closeEvent" : "LITHIUM:lightboxCloseEvent", O2 eSIM Kosten. } ] "event" : "addThreadUserEmailSubscription", ] { "selector" : "#messageview", } if ( neededkeys[count] == key ) { }, "actions" : [ } count++; { "kudosable" : "true", "showCountOnly" : "false", Ich habe auch eben in der Mein Vodafone App gesehen das ein eSim Profil 9,90 Euro kostet. Eventuell brauchst Du Deine 4-stellige PIN. "action" : "rerender" LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "componentId" : "kudos.widget.button", ] } "event" : "deleteMessage", "context" : "envParam:entity", "context" : "", "context" : "", "action" : "rerender" }); ] "accessibility" : false, }, $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); "actions" : [ ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2228045,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. } ","loaderSelector":"#lineardisplaymessageviewwrapper .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } "actions" : [ "event" : "AcceptSolutionAction", "actions" : [ { "action" : "rerender" } "selector" : "#messageview_1",