.attr('aria-expanded','false') "entity" : "2209114", { "forceSearchRequestParameterForBlurbBuilder" : "false", { } { } "event" : "removeThreadUserEmailSubscription", } } { { }, ] "action" : "rerender" { "actions" : [ { "actions" : [ { "context" : "envParam:entity", { }); "linkDisabled" : "false" $(document).ready(function(){ LITHIUM.StarRating('#any_0', true, 2, 'LITHIUM:starRating'); Problem mit der Signalstärke eines Fritz Repeaters 310. { "action" : "rerender" "context" : "envParam:quiltName,product,contextId,contextUrl", "disableKudosForAnonUser" : "false", // Oops. "event" : "MessagesWidgetMessageEdit", Da ich aufgrund der Entfernung des Routers von bspw. $(this).removeAttr('href'); "action" : "rerender" } { }, }, { { } "useSubjectIcons" : "true", "defaultAriaLabel" : "", Als neu kennzeichnen; Lesezeichen; Abonnieren; ... Betreff: Fritz Wlan-Repeater 310 zeigt plötzlich keine Signalstärke mehr an ‎30.05.2020 10:19. { $(this).toggleClass("view-btn-open view-btn-close"); { "disableLabelLinks" : "false", "actions" : [ "revokeMode" : "true", "context" : "envParam:quiltName", element.find('li').removeClass('active'); return; }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/Internet-Endgeraete/thread-id/120306","ajaxErrorEventName":"LITHIUM:ajaxError","token":"kOzjWNWK71I6oIonwSzbdosZ3uMcBRx63RJ8AC1Y-j0. $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); { } { ] "context" : "", sessionStorage.setItem("is_scroll", option); "useCountToKudo" : "false", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2209138,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ] "selector" : "#kudosButtonV2_0", if ( count == neededkeys.length ) { } //var height = $(window).scrollTop(); "action" : "rerender" ] ] "revokeMode" : "true", ] "context" : "", "action" : "addClassName" FRITZ!WLAN Repeater 310 im Überblick • Mehr WLAN-Reichweite für alle verbundenen Geräte Fritz Repeater 310 lässt sich nicht resetten. "event" : "unapproveMessage", { ;(function($) { "event" : "editProductMessage", "context" : "", $('li.close-on-click').on('click',resetMenu); //} else { { "actions" : [ }, CookieManager.setCookie("khoros_custom_announcement_banner", topicIdCustomAnnouncement); "action" : "rerender" Die Power-LED am FRITZ!Repeater leuchtet nicht, der Repeater überträgt keine Daten mehr und die Benutzeroberfläche des Repeaters lässt sich nicht mehr aufrufen. { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", Fritz Wlan-Repeater 310 zeigt plötzlich keine Signalstärke mehr an. LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); ] { } element.find('li').removeClass('active'); $(event.data.selector).addClass('cssmenu-open') }); "actions" : [ Alle Details des FRITZ!Repeater 310 im Überblick. $('.lia-button-wrapper-searchForm-action').removeClass('active'); } if(do_scroll == "true"){ '; }, { LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_7251042a896521","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/Internet-Endgeraete/thread-id/120306&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "actions" : [ ] "closeImageIconURL" : "https://forum.vodafone.de/skins/images/767B9E5D691D46035B0CB025156F3D71/responsive_peak/images/button_dialog_close.svg", } "event" : "addMessageUserEmailSubscription", // console.log('watching: ' + key); "actions" : [ "selector" : "#kudosButtonV2_0", { { "context" : "", } /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }, }, $(document).ready(function(){ } if (element.hasClass('active')) { }, } "actions" : [ "actions" : [ "action" : "rerender" // --> var handleClose = function(event) { var count = 0; Klicken Sie im Menü "WLAN" auf "Sicherheit" bzw. ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#pageInformation","feedbackSelector":".InfoMessage"}); ist Ihr WLAN auf Knopfdruck immer so groß, wie Sie es brauchen. "event" : "addMessageUserEmailSubscription", { "context" : "lia-deleted-state", "event" : "AcceptSolutionAction", "context" : "envParam:quiltName,message,product,contextId,contextUrl", ] "action" : "rerender" "actions" : [ $('.menu-container').on('click','.community-node-menu-btn.active', {'selector' : '.css-node-menu' }, handleClose); }); "includeRepliesModerationState" : "false", Mit dem Fritz WLAN Repeater 310 können Sie die Reichweite und Signalstärke des WLAN Routers verbessern. "context" : "", "event" : "deleteMessage", $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ function createStorage(option){ { { ] ctaHTML += ', Angebote und Informationen für CallYa Kunden, Störungsmeldungen Internet, TV & Telefon DSL, Störungsmeldungen Internet, TV & Telefon Kabel, Störungsmeldungen Mobilfunk, CallYa & LTE. "event" : "removeThreadUserEmailSubscription", } //$('#lia-body').removeClass('lia-window-scroll'); { })(LITHIUM.jQuery); "dialogKey" : "dialogKey" "event" : "editProductMessage", "}); "actions" : [ LITHIUM.MessageBodyDisplay('#bodyDisplay_0', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "actions" : [ "action" : "rerender" "message" : "2209138", "actions" : [ { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", Falls vorhanden, wählen Sie die "Push-Button-Methode (WPS-PBC, Push Button Configuration)". { LITHIUM.AjaxSupport.useTickets = false; }, }, "context" : "lia-deleted-state", { "context" : "envParam:quiltName,product,contextId,contextUrl", FRITZ!Box) her. ] var expireDate = new Date(); Dadurch kann das 5-GHz-Frequenzband des WLAN-Routers auch während der Überprüfung der WLAN-Umgebung auf Radaranlagen (z.B. }, }, ', 'ajax'); }, ;(function($) { { LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'QQfk14fn8vUWMAeSs-kXCnqQ6qmhywqwQgX8JAi1X54. { }, "event" : "removeMessageUserEmailSubscription", "event" : "markAsSpamWithoutRedirect", WLAN Repeater Fritz 310. { "context" : "envParam:quiltName,expandedQuiltName", } $('#vodafone-community-header .lia-search-toggle').click(function() { ] Dadurch verhindern Sie, dass einige WLAN-Geräte keine Verbindung zur FRITZ!Box herstellen können oder versuchen, sich bei gleichlautenden WLAN-Funknetzen in der Umgebung, mit dem falschen WLAN-Router zu verbinden. LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown","menuItemsSelector":".lia-menu-dropdown-items"}}); "disableLabelLinks" : "false", } } "actions" : [ { "context" : "envParam:quiltName", lithstudio: [], { LITHIUM.Dialog({ "actions" : [ logmein: [76, 79, 71, 77, 69, 73, 78], "action" : "rerender" "kudosable" : "true", { "context" : "", Anschließend wird der Repeater zurückgesetzt. "truncateBodyRetainsHtml" : "false", } "action" : "rerender" }, "event" : "unapproveMessage", }); }, // We're good so far. }, } }, "kudosable" : "true", $(this).next().toggle(); }, "actions" : [ } "action" : "rerender" LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); ;(function($) { } LITHIUM.CustomEvent('.lia-custom-event', 'click'); { if(1 < 1){ "disableLabelLinks" : "false", "event" : "MessagesWidgetEditCommentForm", Aktivieren Sie die Option "Name des WLAN-Funknetzes sichtbar". ;(function($) { "eventActions" : [ { "message" : "2209114", "action" : "rerender" "event" : "MessagesWidgetMessageEdit", { "disableLinks" : "false", { Dadurch verhindern Sie, dass einige WLAN-Geräte keine Verbindung zur FRITZ!Box herstellen können und ermöglichen es der FRITZ!Box, WLAN-Geräte im Mesh optimal zu steuern (". "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); } "action" : "rerender" //$(window).scroll(function() { var neededkeys = [76, 79, 71, 77, 69, 73, 78]; "actions" : [ $('.css-menu').removeClass('cssmenu-open') Der Fritz WLAN Repeater 310 ist mit einer WPS-Taste ausgerüstet, mit der Sie. resetMenu(); { } ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_7251042a896521","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/Internet-Endgeraete/thread-id/120306&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "context" : "", ] ] { FRITZ!WLAN Repeater 310 8 Taster und Leuchtdioden Leuchtdioden LED Zustand Bedeutung blinkt Keine Verbindung zur WLAN-Basisstation oder WLAN-Basisstation wird gesucht. }, //$('#lia-body').addClass('lia-window-scroll'); "disableLinks" : "false", .attr('aria-expanded','true'); ] } { } } else { LITHIUM.AjaxSupport.useTickets = false; }, } } } "actions" : [ "event" : "deleteMessage", "event" : "MessagesWidgetEditAnswerForm", createStorage("true"); "event" : "deleteMessage", "actions" : [ $(this).toggleClass('active'); "ajaxEvent" : "LITHIUM:lightboxRenderComponent", LITHIUM.AjaxSupport.fromForm('#form', 'GiveRating', '#ajaxfeedback', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { } LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_7251042ba812fe', 'disableAutoComplete', '#ajaxfeedback_7251042a896521_0', 'LITHIUM:ajaxError', {}, 'CRiLq34Sbvr4qoU6yopQEezs_MOyw1IJK9h9M253L7I. "displayStyle" : "horizontal", "linkDisabled" : "false" "context" : "envParam:feedbackData", "event" : "QuickReply", "event" : "MessagesWidgetCommentForm", Angeschlossen habe ich den Repeater … watching = false; { { "context" : "", Der FRITZ!Repeater stellt nach der Einrichtung keine WLAN-Verbindung zum WLAN-Router (z.B. LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "rerender" } "activecastFullscreen" : false, { Wie du den FRITZ!Repeater 310 einrichtest, zeigen wir dir in diesem Artikel. }, "action" : "rerender" "actions" : [ Fritz Wlan-Repeater 310 zeigt plötzlich keine Sign... Diesen Thema für aktuellen Benutzer floaten, Selfservice-MeinVodafone-App-Quick-Check-Verbrauchsabfrage, Fritz Wlan-Repeater 310 zeigt plötzlich keine Signalstärke mehr an, Betreff: Fritz Wlan-Repeater 310 zeigt plötzlich keine Signalstärke mehr an, Betreff: Kein Update bei FritzBox! LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2209138 .lia-rating-control-passive', '#form_0'); { })(LITHIUM.jQuery); // Pull in global jQuery reference LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Internet-Endgeraete/thread-id/120306","ajaxErrorEventName":"LITHIUM:ajaxError","token":"44PIBgSjFJIyWuzhLUqNKfwmQ__XvOXDrZ7uLjcrVts. Eventuell tritt das Problem nach einem FRITZ!OS-Update auf. "context" : "", }, window.scrollTo(0,position_x.top - 150); } LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); ] "event" : "RevokeSolutionAction", // Set start to true only if the first key in the sequence is pressed { { "actions" : [ var resetMenu = function() { ] } LITHIUM.DropDownMenu({"menuOffsetContainer":".lia-menu-offset-container","hoverLeaveEvent":"LITHIUM:hoverLeave","mouseoverElementSelector":".lia-js-mouseover-menu","menuOpenCssClass":"dropdownHover","clickElementSelector":".lia-js-click-menu","menuElementSelector":".lia-menu-navigation-wrapper","dialogSelector":".lia-panel-dialog-trigger","menuItemsSelector":".lia-menu-dropdown-items","menuClosedEvent":"LITHIUM:menuClosed","closeMenuEvent":"LITHIUM:closeMenu","menuOpenedEvent":"LITHIUM:menuOpened"}); { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Internet-Endgeraete/thread-id/120306","ajaxErrorEventName":"LITHIUM:ajaxError","token":"44PIBgSjFJIyWuzhLUqNKfwmQ__XvOXDrZ7uLjcrVts. Eventuell tritt das Problem nach einem FRITZ!OS-Update auf. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } "event" : "ProductAnswer", window.onclick = function(event) { "actions" : [ LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); "disableLinks" : "false", } "context" : "", }, "initiatorDataMatcher" : "data-lia-kudos-id" { "triggerSelector" : ".lia-panel-dialog-trigger-event-triggerDialogEvent", QR-Code Mithilfe des QR-Codes können Sie die Zugangsdaten für das WLAN-Funknetz auf Ihr Smartphone oder Tablet übertragen, ohne den WLAN-Netzwerkschlüssel einzugeben. var neededkeys = [76, 79, 71, 77, 69, 73, 78]; var keycodes = { "event" : "MessagesWidgetCommentForm", // --> "action" : "rerender" ] var resetMenu = function() { { "actions" : [ "event" : "approveMessage", Execute whatever should happen when entering the right sequence { "actions" : [ ] 100% funktionsfähig! }; "action" : "rerender" Fritzbox im Wohnzimmer (EG), Repeater 2400 im 1. "action" : "rerender" })(LITHIUM.jQuery); "displaySubject" : "true", "dialogContentCssClass" : "lia-panel-dialog-content", "event" : "ProductMessageEdit", ] ] } Die WLAN-Verbindungen müssen anschließend neu eingerichtet werden. /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ } "selector" : "#kudosButtonV2_0", "context" : "envParam:quiltName,product,contextId,contextUrl", var clickedDomElement = $(this); .attr('aria-selected','false'); $('#node-menu li.has-sub>a').on('click', function(){ } \\n\\t\\t\\t\\n\\t\\n\\n\\t\\n\\n\\t\\t\";LITHIUM.AjaxSupport.defaultAjaxErrorHtml = \", \\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\t\\t, '; { "context" : "", WLAN Repeater 310 im Test: Kompakter WLAN-Verstärker. { // enable redirect to login page when "logmein" is typed into the void =) "defaultAriaLabel" : "", { "actions" : [ { ] "event" : "ProductAnswer", "kudosable" : "true", "context" : "envParam:quiltName", $('.menu-container').on('click','.community-node-menu-btn.active', {'selector' : '.css-node-menu' }, handleClose); }, "action" : "rerender" '; { { var handleOpen = function(event) { }, } else { "parameters" : { Execute whatever should happen when entering the right sequence "action" : "rerender" Damit der Repeater funktioniert, sollten Sie die WPA-2-Verschlüsselung im Router einstellen. }); ] } count = 0; $(document).keydown(function(e) { }, $(this).toggleClass("view-btn-open view-btn-close"); } { Bist du sicher, dass du fortfahren möchtest? } }, // Oops, not the right sequence, lets restart from the top. { return; ] } "closeEvent" : "LITHIUM:lightboxCloseEvent", })(LITHIUM.jQuery); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", watching = false; "actions" : [ lithstudio: [], ] LITHIUM.StarRating('#any_0', true, 2, 'LITHIUM:starRating'); "actions" : [ } ] "event" : "AcceptSolutionAction", // console.log(key); "event" : "removeMessageUserEmailSubscription", { logmein: [76, 79, 71, 77, 69, 73, 78], Die Signalstärke-LEDs des FRITZ!Repeaters blinken eine Zeit lang und gehen dann aus. }); { } { } "context" : "", "action" : "rerender" //$('#vodafone-community-header, #vodafone-community-header .lia-search-input-wrapper').css('display','none'); { "message" : "2209114", "componentId" : "kudos.widget.button", .attr('aria-expanded','false'); "actions" : [ "action" : "rerender" Freie gebrauchte Fritz Box 6591 aktivieren. { "event" : "ProductAnswerComment", "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "actions" : [ { createStorage("false"); document.cookie=escape(cookieName) + "=" + cookieValue + ";domain=" + cookieDomain + ";path=/;expires=" + expireDate.toUTCString(); ] "actions" : [ "kudosLinksDisabled" : "false", Bist du sicher, dass du fortfahren möchtest? "truncateBody" : "true", LITHIUM.Text.set({"ajax.GiveRating.loader.feedback.title":"Wird geladen..."}); "componentId" : "forums.widget.message-view", ] "context" : "", Bei der Übernahme werden alle WLAN-Verbindungen zur FRITZ!Box getrennt. LITHIUM.Tooltip({"bodySelector":"body#lia-body","delay":30,"enableOnClickForTrigger":false,"predelay":10,"triggerSelector":"#link_7251042a896521","tooltipContentSelector":"#link_7251042a896521_0-tooltip-element .content","position":["bottom","left"],"tooltipElementSelector":"#link_7251042a896521_0-tooltip-element","events":{"def":"focus mouseover,blur mouseout"},"hideOnLeave":true}); { "action" : "rerender" } ', 'ajax'); { setCookie: function(cookieName, cookieValue) { "context" : "envParam:quiltName,message", "context" : "envParam:entity", im Handbuch. LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_7251042a896521', 'enableAutoComplete', '#ajaxfeedback_7251042a896521_0', 'LITHIUM:ajaxError', {}, 'wxVdj5g2mgGWT_3QDYMJD_Gxe8os5uEDWEkJMIVEVrk. WLAN-Repeater ein. { { "action" : "rerender" "disableLinks" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7","feedbackSelector":".InfoMessage"}); "initiatorBinding" : true, })(LITHIUM.jQuery); LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234214}); "event" : "ProductAnswer", ] return; }, "componentId" : "forums.widget.message-view", if($('body.lia-window-scroll #vodafone-community-header .lia-search-input-wrapper').css('opacity') > 0) { if($('body.lia-window-scroll #vodafone-community-header .lia-search-input-wrapper').css('opacity') > 0) { { FritzBox 6490: LAN-Verbindung wird nur mit 100 Mbi... H E L P -> change your answer machine & please hel... Firmware Update anstoßen (Vodafone Station), Schlechte Modemwerte im Downstream und Upstream, Lieferanten-Buchhaltung / Accounts Payable, Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_7251042a896521_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/Internet-Endgeraete/thread-id/120306&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "showCountOnly" : "false", ] })(LITHIUM.jQuery); { "eventActions" : [ element.siblings('li').children('ul').slideUp(); { Klicken Sie im Menü "WLAN" auf "Funknetz". "componentId" : "forums.widget.message-view", { "event" : "ProductAnswerComment", } "triggerSelector" : ".lia-panel-dialog-trigger-event-triggerDialogEvent", "disallowZeroCount" : "false", // Oops. } else { ;(function($) { "selector" : "#messageview_0", "actions" : [ { $('#node-menu li.active').children('ul').show(); } ] { })(LITHIUM.jQuery); LITHIUM.Dialog({ .attr('aria-expanded','true') "context" : "", //} else { var cookieDomain = 'forum.vodafone.de'; Ein WLAN-Repeater hilft, wenn die Signalstärke deines Netzwerks nicht ausreicht. }, LITHIUM.AjaxSupport.ComponentEvents.set({ element.siblings('li').removeClass('active'); Meist hilft es, wenn Sie den Repeater kurz zurücksetzen. { "event" : "MessagesWidgetMessageEdit", "}); })(LITHIUM.jQuery); // Pull in global jQuery reference "initiatorBinding" : true, LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234214}); ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_7251042a896521_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/Internet-Endgeraete/thread-id/120306&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "context" : "", { ] "}); resetMenu(); { }, "actions" : [ }, ] } }, "action" : "rerender" { count = 0; "entity" : "2209138", var handleOpen = function(event) { $(this).removeClass('active'); { LITHIUM.Auth.CHECK_SESSION_TOKEN = 'W1Xoxc7r7PdY6G1Ohg3v4HqiJ1A4Vy8bXtQxEZ9xRBU. LITHIUM.Dialog.options['1421318708'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; }, } // Oops, not the right sequence, lets restart from the top. auf "Funknetz". $('.lia-autocomplete-footer').append(ctaHTML); ', 'ajax'); "event" : "approveMessage", LITHIUM.AjaxSupport.ComponentEvents.set({ notifCount = parseInt($(this).html()) + notifCount; LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_1","menuItemsSelector":".lia-menu-dropdown-items"}}); }, { { ] { "actions" : [ ] "action" : "rerender" "useCountToKudo" : "false", } "parameters" : { }); "initiatorBinding" : true, "event" : "addMessageUserEmailSubscription", { "action" : "pulsate" } } "event" : "MessagesWidgetAnswerForm", "activecastFullscreen" : false, $('#user-menu .lia-header-nav-component-unread-count').each(function(e) { "action" : "rerender" ] } })(LITHIUM.jQuery); element.siblings('li').find('ul').slideUp(); "action" : "rerender" } //}); "displayStyle" : "horizontal", }); "action" : "rerender" }, } { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", $(document).ready(function(){ }); "ajaxEvent" : "LITHIUM:lightboxRenderComponent", LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, '8tIQID5r5aGOqQV4D1tgN8obJZmXNCtay3xfiQ7ru3M. "event" : "addMessageUserEmailSubscription", { Nachdem Sie die WLAN-Verbindung erfolgreich eingerichtet haben, können Sie den MAC-Adressfilter wieder aktivieren. "event" : "ProductMessageEdit", var notifCount = 0; }); if ( neededkeys[count] == key ) { count++; }, { { Falls der WLAN-Router die mit ihm verbundenen WLAN-Geräte automatisch in das optimale Frequenzband steuern kann ("Band Steering"), aktivieren Sie die entsprechende Option. "event" : "kudoEntity", "messageViewOptions" : "1111110111111111111110111110100101011101" { }); { var watching = false; } else { "action" : "rerender" ] ] "context" : "envParam:quiltName", "context" : "envParam:feedbackData", lithadmin: [] }, { "actions" : [ "closeImageIconURL" : "https://forum.vodafone.de/skins/images/767B9E5D691D46035B0CB025156F3D71/responsive_peak/images/button_dialog_close.svg", }